SAB1401766

DEFB103B antibody from Sigma-Aldrich
No application information provided.

Antibody data

Product number
SAB1401766
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401766, RRID:AB_10608388
Product name
Anti-DEFB103A antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1401766
Antibody type
Polyclonal
Antigen
DEFB103A (NP_061131.1, 1 a.a. ~ 67 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MRIHYLLFALLFLFLVPVPGHGGIINTLQKYYCRV
RGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
Storage
-20C
Provider Type Product Number
- No reagents -