HPA011246

VASN antibody from MilliporeSigma / Merck KGaA
SLITL2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011246
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA011246, RRID:AB_1858720
Product name
Anti-VASN antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA011246
Antibody type
Polyclonal
Antigen
Vasorin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LCPEGFTGLYCESQMGQGTRPSPTPVTPRPPRSLT
LGIEPVSPTSLRVGLQRYLQGSSVQLRSLRLTYRN
LSGPDKRLVTLRLPASLAEYTVTQLRPNATYSVCV
MPLGPGRVPEGEEACGEAHTPPAVHSNH
Storage
-20C
Provider Type Product Number
- No reagents -