Antibody data

Product number
H00003308-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003308-M01, RRID:AB_1204504
Product name
HSPA4 monoclonal antibody (M01), clone 3A11
Provider product page
Abnova Corporation - H00003308-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant HSPA4.
Antigen sequence
MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCT
PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRF
HGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTY
MEEEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK
KLPEMDID
Isotype
IgG
Antibody clone number
3A11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -