Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502697 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Heat Shock 70kDa Protein 4 (HSPA4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HSPA4 antibody: synthetic peptide directed towards the middle region of human HSPA4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKN
KEDQY DHLDAADMTK- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references PHAPI, CAS, and Hsp70 promote apoptosome formation by preventing Apaf-1 aggregation and enhancing nucleotide exchange on Apaf-1.
Kim HE, Jiang X, Du F, Wang X
Molecular cell 2008 Apr 25;30(2):239-47
Molecular cell 2008 Apr 25;30(2):239-47
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: HSPA4 Sample Tissue: Human 721_B Antibody Dilution: 1.0 μg/mL HSPA4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells