HPA010023

HSPA4 antibody from Atlas Antibodies
HS24/P52, HSPH2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010023
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010023, RRID:AB_1851206
Product name
Anti-HSPA4
Provider product page
Atlas Antibodies - HPA010023
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK
VEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEI
EAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQN
GPVDG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -