HPA010023

HSPA4 antibody from Sigma-Aldrich
HS24/P52, HSPH2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010023
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010023, RRID:AB_1851206
Product name
Anti-HSPA4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010023
Antibody type
Polyclonal
Antigen
Heat shock 70 kDa protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK
VEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEI
EAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQN
GPVDG
Storage
-20C
Provider Type Product Number
- No reagents -