HPA011893

SCG2 antibody from Sigma-Aldrich
CHGC, SgII, SN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011893
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011893, RRID:AB_1856656
Product name
Anti-SCG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011893
Antibody type
Polyclonal
Antigen
Secretogranin-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGR
SRSNQLPKAAWIPHVENRQMAYENLNDKDQELGEY
LARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQ
IEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKND
DTP
Storage
-20C
Provider Type Product Number
- No reagents -