ABIN567324

NEGR1 antibody from antibodies-online
IGLON4, KILON, MGC46680, Ntra

Antibody data

Product number
ABIN567324
Provider
antibodies-online
Product name
anti-Neuronal Growth Regulator 1 (NEGR1) (N-Term) antibody
Provider product page
antibodies-online - ABIN567324
Antibody type
Polyclonal
Antigen
The immunogen for anti-NEGR1 antibody: synthetic peptide directed towards the N terminal of human NEGR1
Reactivity
Human
Host
Rabbit
Antigen sequence
WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQI
QNVDV TDDGPYTCSV
Vial size
50 µg
Provider Type Product Number
- No reagents -