HPA011894

NEGR1 antibody from Sigma-Aldrich
IGLON4, KILON, MGC46680, Ntra
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011894
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011894, RRID:AB_1854363
Product name
Anti-NEGR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011894
Antibody type
Polyclonal
Antigen
Neuronal growth regulator 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDG
PYTCSVQTQHTPRTMQVHLTVQVPPKIYDISNDMT
VNEGTNVTLTCLATGKPEPSISWRHISPSAKPFEN
GQYLDIYGITRDQAGEYECSA
Storage
-20C
Provider Type Product Number
- No reagents -