HPA016993

RGMB antibody from MilliporeSigma / Merck KGaA
DRAGON, FLJ90406
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016993
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA016993, RRID:AB_1856216
Product name
Anti-RGMB antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA016993
Antibody type
Polyclonal
Antigen
RGM domain family member B precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KACRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTN
PEVTHDPCNYHSHAGAREHRRGDQNPPSYLFCGLF
GDPHLRTFKDNFQTCKVEGAWPLIDNN
Storage
-20C
Provider Type Product Number
- No reagents -