Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006036-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006036-A01, RRID:AB_563291
- Product name
- RNASE2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant RNASE2.
- Antigen sequence
NMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNI
SNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPV
HLDRII- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Enrichment of the basic/cationic urinary proteome using ion exchange chromatography and batch adsorption.
Thongboonkerd V, Semangoen T, Chutipongtanate S
Journal of proteome research 2007 Mar;6(3):1209-14
Journal of proteome research 2007 Mar;6(3):1209-14
No comments: Submit comment
No validations: Submit validation data