H00079660-B01P

PPP1R3B antibody from Abnova Corporation
FLJ14005, GL, PPP1R4

Antibody data

Product number
H00079660-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079660-B01P, RRID:AB_1579017
Product name
PPP1R3B purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00079660-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PPP1R3B protein.
Antigen sequence
MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLR
PCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQG
LALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTA
ESESFVLDFSQPSADYLDFRNRLQADHVCLENCVL
KDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDF
PCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEF
AVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTK
PHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEK
LGPYY
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -