ABIN404896

TNKS antibody from antibodies-online
PARP-5a, PARP5A, pART5, TIN1, TINF1, TNKS1
Western blot
Recommended by provider
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
ABIN404896
Provider
antibodies-online
Product name
anti-Tankyrase, TRF1-Interacting Ankyrin-Related ADP-Ribose Polymerase (TNKS) (Middle Region) antibody
Provider product page
antibodies-online - ABIN404896
Antibody type
Polyclonal
Antigen
The immunogen for anti-TNKS antibody: synthetic peptide directed towards the middle region of human TNKS
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
Host
Rabbit
Antigen sequence
LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAP
EDKEY QSVEEEMQST
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -