HPA015484

B4GAT1 antibody from Sigma-Aldrich
B3GN-T1, B3GNT1, B3GNT6, BETA3GNTI, iGAT, iGNT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015484
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015484, RRID:AB_1845235
Product name
Anti-B3GNT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015484
Antibody type
Polyclonal
Antigen
N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEQDQYFEFFPPSPRSVDQVKAQLRTALASGGVLD
ASGDYRVYRGLLKTTMDPNDVILATHASVDNLLHL
SGLLERWEGPLSVSVFAATKEEAQLATVLAYALSS
HCPDMRARVAMHLVCPSRYEAAVPDPREPGEFALL
RSCQ
Storage
-20C
Provider Type Product Number
- No reagents -