HPA015484

B4GAT1 antibody from Atlas Antibodies
B3GN-T1, B3GNT1, B3GNT6, BETA3GNTI, iGAT, iGNT
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015484
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015484, RRID:AB_1845235
Product name
Anti-B4GAT1
Provider product page
Atlas Antibodies - HPA015484
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EEQDQYFEFFPPSPRSVDQVKAQLRTALASGGVLD
ASGDYRVYRGLLKTTMDPNDVILATHASVDNLLHL
SGLLERWEGPLSVSVFAATKEEAQLATVLAYALSS
HCPDMRARVAMHLVCPSRYEAAVPDPREPGEFALL
RSCQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -