HPA010024

CADM2 antibody from Atlas Antibodies
IGSF4D, Necl-3, NECL3, SynCAM2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010024
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010024, RRID:AB_2068039
Product name
Anti-CADM2
Provider product page
Atlas Antibodies - HPA010024
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLP
EPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDN
GTYRCEATNTIGQSSAEYVLIVHDVPNTLLPTTII
PSLTTATVTTTVAITTSPTTSATTSSIRDPNALA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -