HPA010024

CADM2 antibody from Sigma-Aldrich
IGSF4D, Necl-3, NECL3, SynCAM2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010024
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010024, RRID:AB_2068039
Product name
Anti-CADM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010024
Antibody type
Polyclonal
Antigen
Cell adhesion molecule 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLP
EPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDN
GTYRCEATNTIGQSSAEYVLIVHDVPNTLLPTTII
PSLTTATVTTTVAITTSPTTSATTSSIRDPNALA
Storage
-20C
Provider Type Product Number
- No reagents -