H00066036-M01

MTMR9 antibody from Abnova Corporation
C8orf9, DKFZp434K171, LIP-STYX, MTMR8
No application information provided.

Antibody data

Product number
H00066036-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00066036-M01, RRID:AB_1137317
Product name
MTMR9 monoclonal antibody (M01), clone 4A9
Provider product page
Abnova Corporation - H00066036-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MTMR9.
Antigen sequence
LQQKTMSLWSWVNQPSELSKFTNPLFEANNLVIWP
SVAPQSLPLWEGIFLRWNRSSKYLDEAYEEMVNII
EYNKELQAKVNILRRQLAELETEDGMQESP
Isotype
IgG
Antibody clone number
4A9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -