HPA003028

EIF3L antibody from Sigma-Aldrich
EIF3EIP, EIF3S11, EIF3S6IP, HSPC021, HSPC025
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003028
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003028, RRID:AB_1078726
Product name
Anti-EIF3EIP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003028
Antibody type
Polyclonal
Antigen
Eukaryotic translation initiation factor 3 subunit L recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RMQKGDPQVYEELFSYSCPKFLSPVVPNYDNVHPN
YHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTT
MPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTS
GISALDGEFQSASEVDFYIDKDMIHIADTKVAR
Storage
-20C
Provider Type Product Number
- No reagents -