Antibody data

Product number
H00006760-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006760-M07, RRID:AB_1137474
Product name
SS18 monoclonal antibody (M07), clone 1C8
Provider product page
Abnova Corporation - H00006760-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SS18.
Antigen sequence
APHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSM
NMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQ
PMGNYGPRPNMSMQPNQGPMMHQQPPSQQYN
Isotype
IgG
Antibody clone number
1C8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -