Antibody data

Product number
H00005179-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005179-M04, RRID:AB_10757356
Product name
PENK monoclonal antibody (M04), clone 9E7
Provider product page
Abnova Corporation - H00005179-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PENK.
Antigen sequence
MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSY
RLVRPADISFLACVMECEGKLPSLKIWETCKELLQ
LSRPELPQDGTSTLRENSKPEESHLLAKRYGGFMK
RYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFM
KKDAEEDDSLANSSDLLKELLETGDNRERSHHQDG
SDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRY
GGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDE
EGESYSKEVPEMEKRYGGFMRF
Isotype
IgG
Antibody clone number
9E7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -