HPA013138

PENK antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013138
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013138, RRID:AB_1855191
Product name
Anti-PENK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013138
Antibody type
Polyclonal
Antigen
Proenkephalin A precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ECSQDCATCSYRLVRPADINFLACVMECEGKLPSL
KIWETCKELLQLSKPELPQDGTSTLRENSKPEESH
LLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGS
EILAKRYGGFMKKDAEE
Storage
-20C
Provider Type Product Number
- No reagents -