Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00252969-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00252969-M01, RRID:AB_426146
- Product name
- NEIL2 monoclonal antibody (M01), clone 1B7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant NEIL2.
- Antigen sequence
MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPA
SLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPT
PEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSA
ELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGS
VWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFL
AFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEAL
GQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHP
LSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRP
QHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWC
PQCQPQLSEEPEQCQFS- Isotype
- IgG
- Antibody clone number
- 1B7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NEIL2 expression in transfected 293T cell line by NEIL2 monoclonal antibody (M01), clone 1B7.Lane 1: NEIL2 transfected lysate(36.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NEIL2 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol