Antibody data

Product number
H00002760-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002760-M02, RRID:AB_1575229
Product name
GM2A monoclonal antibody (M02), clone 2C8
Provider product page
Abnova Corporation - H00002760-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GM2A.
Antigen sequence
WIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEP
LRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWL
TTGNYRIESVLSSSGKRLGCIKIAASLKGI
Isotype
IgG
Antibody clone number
2C8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -