HPA008063

GM2A antibody from Sigma-Aldrich
SAP-3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008063
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008063, RRID:AB_1849842
Product name
Anti-GM2A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008063
Antibody type
Polyclonal
Antigen
Ganglioside GM2 activator precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEK
EVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGE
PCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLE
LPSWLTTGNYRIESVLSSSGKRLGCIKIAA
Storage
-20C
Provider Type Product Number
- No reagents -