H00011198-M01
antibody from Abnova Corporation
Targeting: SUPT16H
CDC68, FACT, FACTP140, FLJ10857, FLJ14010, SPT16/CDC68
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011198-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011198-M01, RRID:AB_622390
- Product name
- SUPT16H monoclonal antibody (M01), clone 1D12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SUPT16H.
- Antigen sequence
PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEK
EGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQ
GSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPC
DGE- Isotype
- IgG
- Antibody clone number
- 1D12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SUPT16H monoclonal antibody (M01), clone 1D12 Western Blot analysis of SUPT16H expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SUPT16H is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol