HPA007470

CAPZA2 antibody from Sigma-Aldrich
CAPPA2, CAPZ
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007470
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007470, RRID:AB_1845985
Product name
Anti-CAPZA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007470
Antibody type
Polyclonal
Antigen
F-actin-capping protein subunit alpha-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHL
RKEATDPRPCEVENAVESWRTSVETALRAYVKEHY
PNGVCTVYGKKIDGQQTIIACIESHQFQA
Storage
-20C
Provider Type Product Number
- No reagents -