HPA007644

HNRNPK antibody from Sigma-Aldrich
CSBP, HNRPK, TUNP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007644
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007644, RRID:AB_1079077
Product name
Anti-HNRNPK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007644
Antibody type
Polyclonal
Antigen
Heterogeneous nuclear ribonucleoprotein K recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSR
NTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDY
NASVS
Storage
-20C
Provider Type Product Number
- No reagents -