Antibody data

Product number
H00377630-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00377630-M01, RRID:AB_509093
Product name
DUB3 monoclonal antibody (M01), clone 3G12
Provider product page
Abnova Corporation - H00377630-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DUB3.
Antigen sequence
ESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPDVLV
IHQSKYKCGMKNHHPEQQSSLLNLSSTTPTHQESM
NTGTLASLRGRARRSKGKNKHSKRALLVCQ
Isotype
IgG
Antibody clone number
3G12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.