H00377630-A01

USP17L2 antibody from Abnova Corporation
DUB3
No application information provided.

Antibody data

Product number
H00377630-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00377630-A01, RRID:AB_463378
Product name
DUB3 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00377630-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant DUB3.
Antigen sequence
ESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPDVLV
IHQSKYKCGMKNHHPEQQSSLLNLSSTTPTHQESM
NTGTLASLRGRARRSKGKNKHSKRALLVCQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.