Antibody data

Product number
H00007415-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007415-M03, RRID:AB_1205165
Product name
VCP monoclonal antibody (M03), clone 4A8
Provider product page
Abnova Corporation - H00007415-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant VCP.
Antigen sequence
MVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTL
IARAVANETGAFFFLINGPEIMSKLAGESESNLRK
AFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERR
IVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALR
RFGRFDREVDIGIPDATGRLEILQIHTKNMKLADD
VDLEQVANETHGHVGADLAALCSEAALQAIRKKMD
LIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSA
LRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVE
HPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIAN
ECQANFISIKGPELLTMWFGESEANVREIFDKARQ
AAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQ
ILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGR
LDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLE
FLAKMTNGFSGADLTEICQRACKLAIRESIESEIR
RERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFA
RRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQ
GGAGPSQGSGGGTGGSVYTEDNDDDLYG
Isotype
IgG
Antibody clone number
4A8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -