HPA012814

VCP antibody from Atlas Antibodies
IBMPFD, p97
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA012814
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012814, RRID:AB_1234285
Product name
Anti-VCP
Provider product page
Atlas Antibodies - HPA012814
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAI
RESIESEIRRERERQTNPSAMEVEEDDPVPEIRRD
HFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFG
SFRF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -