Antibody data

Product number
H00147409-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00147409-M06, RRID:AB_10901875
Product name
DSG4 monoclonal antibody (M06), clone 6E7
Provider product page
Abnova Corporation - H00147409-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DSG4.
Antigen sequence
EPPGIADMWDVRSTNATSAILTAKQVLSPGFYEIP
ILVKDSYNRACELAQMVQLYACDCDDNHMCLDSGA
AGIYTEDITGDTYGPVTEDQAGVSNVGLGP
Isotype
IgG
Antibody clone number
6E7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -