HPA009177

PIP antibody from Atlas Antibodies
GCDFP-15, GCDFP15, GPIP4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009177
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009177, RRID:AB_1845459
Product name
Anti-PIP
Provider product page
Atlas Antibodies - HPA009177
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLIS
SIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQ
IAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILK
VE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -