ABIN632150

antibody from antibodies-online

Targeting: LIPI CT17, LPDL, mPA-PLA1beta, PLA1C, PRED5

Western blot

Antibody data

Submit

Validation data

Product number: ABIN632150 - Provider product page
Provider: antibodies-online
Product name: anti-Lipase I (LIPI) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: LIPI antibody was raised using the middle region of LIPI corresponding to a region with amino acids YFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKIL
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

LIPI protein structure - ABIN632150 shown in red.