HPA027405

GAK antibody from MilliporeSigma / Merck KGaA
DNAJC26
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027405
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027405, RRID:AB_10611111
Product name
Anti-GAK antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027405
Antibody type
Polyclonal
Antigen
cyclin G associated kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ITRNTTPMYRTPEIIDLYSNFPIGEKQDIWALGCI
LYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTV
FH
Storage
-20C
Provider Type Product Number
- No reagents -