HPA027463

GAK antibody from Sigma-Aldrich
DNAJC26
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027463
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027463, RRID:AB_10601959
Product name
Anti-GAK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027463
Antibody type
Polyclonal
Antigen
cyclin G associated kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKN
RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDT
GQAEFLLLTELCKGQLVE
Storage
-20C
Provider Type Product Number
- No reagents -