Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA045885 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-RBM11
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LYGRPINVQYRFGSSRSSEPANQSFESCVKINSHN
YRNEEMLVGRSSFPMQYFPINNTSLP- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Apoptotic Cell-Derived Extracellular Vesicles Promote Malignancy of Glioblastoma Via Intercellular Transfer of Splicing Factors
Pavlyukov M, Yu H, Bastola S, Minata M, Shender V, Lee Y, Zhang S, Wang J, Komarova S, Wang J, Yamaguchi S, Alsheikh H, Shi J, Chen D, Mohyeldin A, Kim S, Shin Y, Anufrieva K, Evtushenko E, Antipova N, Arapidi G, Govorun V, Pestov N, Shakhparonov M, Lee L, Nam D, Nakano I
Cancer Cell 2018;34(1):119-135.e10
Cancer Cell 2018;34(1):119-135.e10
No comments: Submit comment
No validations: Submit validation data