HPA009178

CD79B antibody from Atlas Antibodies
B29, IGB
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009178
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009178, RRID:AB_1078483
Product name
Anti-CD79B
Provider product page
Atlas Antibodies - HPA009178
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTG
EVKWSVGEHPGQE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -