HPA009178

CD79B antibody from Sigma-Aldrich
B29, IGB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009178
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009178, RRID:AB_1078483
Product name
Anti-CD79B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009178
Antibody type
Polyclonal
Antigen
B-cell antigen receptor complex-associated protein beta-chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTG
EVKWSVGEHPGQE
Storage
-20C
Provider Type Product Number
- No reagents -