Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA017753 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA017753, RRID:AB_10600805
- Product name
- Anti-DLC1
- Antibody type
- Polyclonal
- Reactivity
- Human, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQA
SMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRP
MGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSD
EDNNADLCLTDDKQVLNTQGQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The transcriptional coactivators megakaryoblastic leukemia 1/2 mediate the effects of loss of the tumor suppressor deleted in liver cancer 1
Muehlich S, Hampl V, Khalid S, Singer S, Frank N, Breuhahn K, Gudermann T, Prywes R
Oncogene 2011 December;31(35):3913-3923
Oncogene 2011 December;31(35):3913-3923
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY405427)
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & vesicles.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows distinct positivity of microvilli in glandular cells.
- Sample type
- HUMAN