HPA017753

DLC1 antibody from Sigma-Aldrich
ARHGAP7, DLC-1, HP, p122-RhoGAP, STARD12
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017753
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017753, RRID:AB_10600805
Product name
Anti-DLC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017753
Antibody type
Polyclonal
Antigen
deleted in liver cancer 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQA
SMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRP
MGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSD
EDNNADLCLTDDKQVLNTQGQ
Storage
-20C
Provider Type Product Number
- No reagents -