HPA026797

DGKQ antibody from Sigma-Aldrich
DAGK, DAGK4, DAGK7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026797
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026797, RRID:AB_10600902
Product name
Anti-DGKQ antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026797
Antibody type
Polyclonal
Antigen
diacylglycerol kinase, theta 110kDa recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSV
SHIYSSQGAVVLDVACFAEAERLYMLLKDMAVRGR
LLTALVLPDLLHAKLPPDSCPLLVFVNPKSG
Storage
-20C
Provider Type Product Number
- No reagents -