Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1108890 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ring Finger Protein 138 (RNF138) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RNF138 antibody: synthetic peptide directed towards the C terminal of human RNF138.
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
LFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRH
QFDYGEFVNLQLDEE- Epitope
- C-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references NARF, an nemo-like kinase (NLK)-associated ring finger protein regulates the ubiquitylation and degradation of T cell factor/lymphoid enhancer factor (TCF/LEF).
Yamada M, Ohnishi J, Ohkawara B, Iemura S, Satoh K, Hyodo-Miura J, Kawachi K, Natsume T, Shibuya H
The Journal of biological chemistry 2006 Jul 28;281(30):20749-60
The Journal of biological chemistry 2006 Jul 28;281(30):20749-60
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Transfected 293T; WB Suggested Anti-RNF138 Antibody Titration: 0.2-1 ug/ml. Positive Control: Transfected 293T; RNF138 antibody - C-terminal region (AP42164PU-N) in Transfected 293T cells using Western Blot
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Jurkat; Host: Rabbit . Target Name: RNF138 . Sample Tissue: Jurkat . Antibody Dilution: 1.0ug/ml. RNF138 is supported by BioGPS gene expression data to be expressed in Jurkat.; RNF138 antibody - C-terminal region (AP42164PU-N) in Human Jurkat cells using Western Blot