H00007004-M01
antibody from Abnova Corporation
Targeting: TEAD4
EFTR-2, RTEF-1, TCF13L1, TEF-3, TEFR-1
Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007004-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007004-M01, RRID:AB_489867
- Product name
- TEAD4 monoclonal antibody (M01), clone 5H3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TEAD4.
- Antigen sequence
ARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTY
AVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVA
SSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSP
SYSDP- Isotype
- IgG
- Antibody clone number
- 5H3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Integrative genomics analysis reveals the multilevel dysregulation and oncogenic characteristics of TEAD4 in gastric cancer.
Induction of a trophoblast-like phenotype by hydralazine in the p19 embryonic carcinoma cell line.
Transcription factor TEAD4 regulates expression of myogenin and the unfolded protein response genes during C2C12 cell differentiation.
Lim B, Park JL, Kim HJ, Park YK, Kim JH, Sohn HA, Noh SM, Song KS, Kim WH, Kim YS, Kim SY
Carcinogenesis 2014 May;35(5):1020-7
Carcinogenesis 2014 May;35(5):1020-7
Induction of a trophoblast-like phenotype by hydralazine in the p19 embryonic carcinoma cell line.
O'Driscoll CM, Coulter JB, Bressler JP
Biochimica et biophysica acta 2013 Mar;1833(3):460-7
Biochimica et biophysica acta 2013 Mar;1833(3):460-7
Transcription factor TEAD4 regulates expression of myogenin and the unfolded protein response genes during C2C12 cell differentiation.
Benhaddou A, Keime C, Ye T, Morlon A, Michel I, Jost B, Mengus G, Davidson I
Cell death and differentiation 2012 Feb;19(2):220-31
Cell death and differentiation 2012 Feb;19(2):220-31
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TEAD4 monoclonal antibody (M01), clone 5H3 Western Blot analysis of TEAD4 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of TEAD4 expression in transfected 293T cell line by TEAD4 monoclonal antibody (M01), clone 5H3.Lane 1: TEAD4 transfected lysate(34.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TEAD4 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of TEAD4 transfected lysate using anti-TEAD4 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TEAD4 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol