HPA003011

GNAZ antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003011
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003011, RRID:AB_1078918
Product name
Anti-GNAZ antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003011
Antibody type
Polyclonal
Antigen
Guanine nucleotide-binding protein Gz subunit alpha recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFA
LTGPAESKGEITPELLGVMRRLWADPGAQACFSRS
SEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSR
DMTTGIVENKFTFKELTFKMVDVGGQRSERKKWIH
CFEGVTAIIF
Storage
-20C
Provider Type Product Number
- No reagents -