HPA012869

SYT7 antibody from Sigma-Aldrich
IPCA-7, MGC150517, PCANAP7, SYT-VII
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012869
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012869, RRID:AB_1857698
Product name
Anti-SYT7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012869
Antibody type
Polyclonal
Antigen
Synaptotagmin-7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSLETVGTPDSGRGRSEKKAIKLPAGGKAVNTAPV
PGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSP
GSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVK
IMKAQELPAKDFSGTSDPFVKIYLLP
Storage
-20C
Provider Type Product Number
- No reagents -