Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003077-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003077-M01, RRID:AB_606380
- Product name
- HFE monoclonal antibody (M01), clone 1G12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HFE.
- Antigen sequence
SHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFC
PDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLE
RDCPAQLQQLLELGRGVLDQQ- Isotype
- IgG
- Antibody clone number
- 1G12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Hemochromatosis enhances tumor progression via upregulation of intracellular iron in head and neck cancer.
Lenarduzzi M, Hui AB, Yue S, Ito E, Shi W, Williams J, Bruce J, Sakemura-Nakatsugawa N, Xu W, Schimmer A, Liu FF
PloS one 2013;8(8):e74075
PloS one 2013;8(8):e74075
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HFE monoclonal antibody (M01), clone 1G12. Western Blot analysis of HFE expression in A-431.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of HFE expression in transfected 293T cell line by HFE monoclonal antibody (M01), clone 1G12.Lane 1: HFE transfected lysate(40.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HFE is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to HFE on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol