HPA017276

HFE antibody from Sigma-Aldrich
HLA-H
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017276
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017276, RRID:AB_1850677
Product name
Anti-HFE antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017276
Antibody type
Polyclonal
Antigen
Hereditary hemochromatosis protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHV
TSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEF
EPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEH
PGLDQPLIVIWEPSPS
Storage
-20C
Provider Type Product Number
- No reagents -