Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503489 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Tubulin, Alpha, 3C (TUBA3C) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TUBA3C antibody: synthetic peptide directed towards the N terminal of human TUBA3C
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVD
LEPTV VDEVRTGTYR- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
Jin J, Smith FD, Stark C, Wells CD, Fawcett JP, Kulkarni S, Metalnikov P, O'Donnell P, Taylor P, Taylor L, Zougman A, Woodgett JR, Langeberg LK, Scott JD, Pawson T
Current biology : CB 2004 Aug 24;14(16):1436-50
Current biology : CB 2004 Aug 24;14(16):1436-50
No comments: Submit comment
No validations: Submit validation data